PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g18120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 694aa    MW: 75670.8 Da    PI: 6.2723
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g18120genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.78.7e-32279336260
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                dDgynWrKYGqK vkgse+prsYY+Ct ++C+vkkkvers+ +++++ei+Y+g Hnh+k
  Tp6g18120 279 DDGYNWRKYGQKLVKGSEYPRSYYKCTNPNCQVKKKVERSR-EGHITEIIYKGAHNHSK 336
                8****************************************.***************85 PP

2WRKY103.89.3e-33492550159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+++d k v++tYeg+Hnh+
  Tp6g18120 492 LDDGYRWRKYGQKVVKGNPNPRSYYKCTAPGCTVRKHVERASHDLKSVITTYEGKHNHD 550
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-28275337IPR003657WRKY domain
SuperFamilySSF1182902.35E-25276337IPR003657WRKY domain
SMARTSM007748.6E-35278336IPR003657WRKY domain
PfamPF031064.2E-24279334IPR003657WRKY domain
PROSITE profilePS5081123.594279337IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-36477552IPR003657WRKY domain
SuperFamilySSF1182901.7E-28484552IPR003657WRKY domain
PROSITE profilePS5081138.136487552IPR003657WRKY domain
SMARTSM007741.8E-37492551IPR003657WRKY domain
PfamPF031069.0E-25493550IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 694 aa     Download sequence    Send to blast
MAGFDENVAV MGEWVPRSPS PGTLFSSAIG EEKSSKRVLE RELSLNHGQV NGLEEDTTGN  60
NNKDASQTNI LRGRLSERIA ARAGFNTPRL NTENIRSKTD FSIDASLRSP CLTISSPGLS  120
PATLLESPVF LSNPLAQPSP TTGKFPFLPG INSNVLSSAA SDKAKDEFFD DIGASFTFHP  180
VSRSSSSFFQ GTTEMMQVEY GNYNNRSSYQ SPEEKVKLCS QNIEISHLYG IETEQSGLKR  240
KTSDATTNTG LETVDHQDEE EEGEEQRRGD SIVGGAPADD GYNWRKYGQK LVKGSEYPRS  300
YYKCTNPNCQ VKKKVERSRE GHITEIIYKG AHNHSKPPPN RRSGMQVDGT EQAEQQQQQQ  360
KDSTATWVNC NNTQQIGSNE NNVEEGSRGF EYGNQSVSVQ AQTGSQFESC DVNGGVAVVD  420
ASSTFSNEED EDDRGTHGSV SLGYDGGGGG EGDESESKRR KLEAYAAEMS GATRAIREPR  480
VVVQTTSDVD ILDDGYRWRK YGQKVVKGNP NPRSYYKCTA PGCTVRKHVE RASHDLKSVI  540
TTYEGKHNHD VPAARNSSHG GGSGGGNGNS GVSAAQTQHY HNGHHSEPPR GRFDRQLTAN  600
SQSPFGRPFS FQPHLGPPSG YSFGLGQTGL GNLSIPGLAF GQGKIPVLSH PYMTHQPVGM  660
SEAMMQRGME PKVEPVSETE QSVYNQIMSR LPQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-37279553878Probable WRKY transcription factor 4
2lex_A3e-37279553878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4183080.0AF418308.1 Arabidopsis thaliana WRKY transcription factor 2 (WRKY2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006401355.10.0hypothetical protein EUTSA_v10012829mg
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLV4LSF00.0V4LSF0_EUTSA; Uncharacterized protein
STRINGAT5G56270.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79542740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY DNA-binding protein 2